USD 375.00
5 Days
Goat Anti-CHRNB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1. |
USD 375.00
5 Days
Goat Anti-CHRNB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1. |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CHRNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CHRNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV |