Antibodies

View as table Download

Chicken Polyclonal ANKLE2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANKLE2 antibody was raised against a 19 amino acid synthetic peptide near the center of human ANKLE2.

Rabbit Polyclonal Anti-ANKLE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANKLE2 Antibody: synthetic peptide directed towards the middle region of human ANKLE2. Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG