Antibodies

Jump to Filters
View as table Download
CD99L2 Rabbit Polyclonal Antibody
TA343007

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD99L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD99L2 antibody: synthetic peptide directed towards the middle region of human CD99L2. Synthetic peptide located within the following region: RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG
CD99L2 Rabbit Polyclonal Antibody
TA357718

USD 360.00

5 Days

CD99L2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated