Goat Anti-CDH23 / USH1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNISLYENVTVGTS, from the internal region of the protein sequence according to NP_071407.3; NP_443068.1. |
Goat Anti-CDH23 / USH1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNISLYENVTVGTS, from the internal region of the protein sequence according to NP_071407.3; NP_443068.1. |
Rabbit Polyclonal Anti-CDH23 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDH23 antibody is: synthetic peptide directed towards the N-terminal region of Human CDH23. Synthetic peptide located within the following region: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD |
Rabbit Polyclonal Anti-CDH23 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDH23 antibody: synthetic peptide directed towards the middle region of human CDH23. Synthetic peptide located within the following region: DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI |
Anti-CDH23 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cadherin-related 23cadherin-related 23 |