Antibodies

Jump to Filters
View as table Download
GPR183 Rabbit Polyclonal Antibody
TA337161

USD 424.00

5 Days

Rabbit Polyclonal EBI2/GPR183 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 300-350 of human EBI2 was used as the immunogen.
GPR183 Rabbit Polyclonal Antibody
TA331259

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR183 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR183 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR183. Synthetic peptide located within the following region: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK