Antibodies

Jump to Filters
View as table Download
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA338168

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTH2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTH2R antibody is: synthetic peptide directed towards the C-terminal region of Human PTH2R. Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED