Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC5A9

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA