Antibodies

View as table Download

Rabbit Polyclonal Anti-SEMA4F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F. Synthetic peptide located within the following region: PLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV

Rabbit Polyclonal Anti-SEMA4F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F. Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL