Antibodies

Jump to Filters
View as table Download
AHI1 Rabbit Polyclonal Antibody
TA344981

USD 475.00

5 Days

Rabbit Polyclonal Anti-AHI1 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ahi1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV
AHI1 Rabbit Polyclonal Antibody
TA308513

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHI1 (Abelson helper integration site 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 42 of AHI1 (Uniprot ID#Q8N157)