Antibodies

Jump to Filters
View as table Download
ALAS1 Rabbit Polyclonal Antibody
TA336223

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
ALAS1 Rabbit Polyclonal Antibody
TA373430

USD 220.00

3 Weeks

ALAS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ALAS1 (NP_954635.1).
Modifications Unmodified