Antibodies

View as table Download

Rabbit Polyclonal Anti-ANKRD5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRD5 antibody: synthetic peptide directed towards the middle region of human ANKRD5. Synthetic peptide located within the following region: LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK

Rabbit Polyclonal Anti-ANKRD5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRD5 antibody: synthetic peptide directed towards the N terminal of human ANKRD5. Synthetic peptide located within the following region: MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA