Antibodies

View as table Download

Rabbit Polyclonal Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Apolipoprotein B (APOB) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Affinity purified Apolipoprotein-B (hLDL)

Goat Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2.

ApoB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-330 of human ApoB (NP_000375.2).
Modifications Unmodified