Rabbit Polyclonal Anti-CCDC50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV |
Rabbit Polyclonal Anti-CCDC50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: KAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPP |
CCDC50 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China