Antibodies

Jump to Filters
View as table Download
CDC45L (CDC45) Rabbit Polyclonal Antibody
TA308625

USD 415.00

5 Days

Rabbit polyclonal antibody to CDC45L (CDC45 cell division cycle 45-like (S. cerevisiae))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 566 of CDC45L (Uniprot ID#O75419)
CDC45L (CDC45) Rabbit Polyclonal Antibody
TA339196

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC45

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC45L antibody: synthetic peptide directed towards the C terminal of human CDC45L. Synthetic peptide located within the following region: VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED
CDC45L (CDC45) Rabbit Polyclonal Antibody
TA374507

USD 220.00

3 Weeks

CDC45 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CDC45 (NP_003495.1).
Modifications Unmodified