Antibodies

Jump to Filters
View as table Download
Cysteine Dioxygenase Type 1 (CDO1) Rabbit Polyclonal Antibody
TA349155

USD 484.00

5 Days

Rabbit Polyclonal Anti-CDO1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDO1 antibody was raised against a 19 amino acid peptide near the amino terminus of human CDO1.
Cdo1 Rabbit Polyclonal Antibody
TA340024

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cdo1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cdo1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cdo1. Synthetic peptide located within the following region: RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTG
Cysteine Dioxygenase Type 1 (CDO1) Rabbit Polyclonal Antibody
TA374592

USD 220.00

3 Weeks

CDO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2).
Modifications Unmodified