Antibodies

View as table Download

Rabbit Polyclonal anti-CGRRF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CGRRF1 antibody: synthetic peptide directed towards the middle region of human CGRRF1. Synthetic peptide located within the following region: KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

CGRRF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human CGRRF1 (NP_006559.1).
Modifications Unmodified