Antibodies

View as table Download

Rabbit polyclonal anti-CKI-?1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1.

Rabbit polyclonal anti-Csnk1g1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Csnk1g1 antibody: synthetic peptide directed towards the middle region of mouse Csnk1g1. Synthetic peptide located within the following region: FDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEV

Rabbit polyclonal anti-CSNK1G1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1. Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW

CSNK1G1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2).
Modifications Unmodified

CSNK1G1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2).
Modifications Unmodified