Antibodies

Jump to Filters
View as table Download
CYP2W1 Rabbit Polyclonal Antibody
TA343055

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP2W1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2W1 antibody: synthetic peptide directed towards the C terminal of human CYP2W1. Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA
CYP2W1 Rabbit Polyclonal Antibody
TA375290

USD 220.00

3 Weeks

CYP2W1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 141-490 of human CYP2W1 (NP_060251.2).
Modifications Unmodified