Rabbit monoclonal antibody against DLC8 (N-term) (EP1660Y )
Applications | IF, IHC, IP, WB |
Reactivities | Mouse, Rat, Human, Fruit fly (Drosophila melanogaster) |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against DLC8 (N-term) (EP1660Y )
Applications | IF, IHC, IP, WB |
Reactivities | Mouse, Rat, Human, Fruit fly (Drosophila melanogaster) |
Conjugation | Unconjugated |
Rabbit anti-DYNLL1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DYNLL1 |
Rabbit Polyclonal Anti-DYNLL1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1. Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL |
Rabbit Polyclonal Anti-DYNLL1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the N terminal of human DYNLL1. Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY |
Rabbit Polyclonal Anti-DYNLL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DYNLL1 |
DYNLL1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1). |
Modifications | Unmodified |
DYNLL1 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human DYNLL1 |