Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Chimpanzee, Chicken, Human, Mouse, Rat, Zebrafish, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ECT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL |
Rabbit Polyclonal Anti-ECT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG |
ECT2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ECT2. |
| Modifications | Unmodified |
Active filters
Target Symbol
- ECT2
Applications
- WB
Isotypes
- IgG