Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-EPN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPN2 Antibody: A synthesized peptide derived from human EPN2 |
Antibodies
View as table Download
Rabbit polyclonal anti-EPN2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPN2. |
Rabbit polyclonal Anti-EPN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM |
Rabbit polyclonal Anti-EPN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN |
EPN2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-300 of human EPN2 (NP_683723.2). |
| Modifications | Unmodified |
Epn2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Epn2 (XP_006532226.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPN2
Applications
- WB
Isotypes
- IgG