Antibodies

Jump to Filters
View as table Download
Proteinase Activated Receptor 3 (F2RL2) Rabbit Polyclonal Antibody
TA342829

USD 375.00

5 Days

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK
Proteinase Activated Receptor 3 (F2RL2) Rabbit Polyclonal Antibody
TA351490

USD 345.00

In Stock

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2RL2