Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FRK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRK antibody: synthetic peptide directed towards the N terminal of human FRK. Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH |
Rabbit Polyclonal Anti-FRK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRK antibody: synthetic peptide directed towards the middle region of human FRK. Synthetic peptide located within the following region: DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG |
Rabbit Polyclonal Anti-FRK Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FRK |
FRK rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FRK |
FRK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human FRK (NP_002022.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FRK
Applications
- WB
Isotypes
- IgG