Antibodies

Jump to Filters
View as table Download
FSTL1 Goat Polyclonal Antibody
TA302822

USD 375.00

In Stock

Goat Polyclonal Antibody against FSTL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TAEKTKRVSTKEI, from the C Terminus of the protein sequence according to NP_009016.1.
FSTL1 Rabbit Polyclonal Antibody
TA590234

USD 409.00

In Stock

Rabbit Polyclonal FSTL1 Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
FSTL1 Rabbit Polyclonal Antibody
TA340152

USD 375.00

5 Days

Rabbit Polyclonal Anti-FSTL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FSTL1 antibody: synthetic peptide directed towards the C terminal of human FSTL1. Synthetic peptide located within the following region: LNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKN
FSTL1 Rabbit Polyclonal Antibody
TA376364

USD 220.00

3 Weeks

FSTL1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human FSTL1 (NP_009016.1).
Modifications Unmodified