Rabbit Polyclonal Anti-GABARAPL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV |
Rabbit Polyclonal Anti-Gabarapl2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Gabarapl2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF |
GABARAPL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL2 (NP_009216.1). |
| Modifications | Unmodified |
GABARAPL2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL2 (NP_009216.1). |
| Modifications | Unmodified |
GABARAPL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human GABARAPL2 |
GABARAPL2 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China