Antibodies

Jump to Filters
View as table Download
GATM Rabbit Polyclonal Antibody
TA346701

USD 475.00

5 Days

Rabbit Polyclonal Anti-GATM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
GATM Rabbit Polyclonal Antibody
TA376497

USD 220.00

3 Weeks

GATM Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 124-423 of human GATM (NP_001473.1).
Modifications Unmodified