Antibodies

View as table Download

GPC4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC4

Rabbit Polyclonal Anti-GPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ

GPC4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC4

GPC4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2).
Modifications Unmodified