Antibodies

View as table Download

Rabbit Polyclonal Anti-IKZF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IKZF3 antibody is: synthetic peptide directed towards the middle region of Human IKZF3. Synthetic peptide located within the following region: YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQS

Rabbit polyclonal anti-IKZF3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IKZF3.

IKZF3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-450 of human IKZF3 (NP_036613.2).
Modifications Unmodified

IKZF3 Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKZF3