Antibodies

View as table Download

Rabbit polyclonal KLF9 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KLF9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-57 amino acids from the N-terminal region of human KLF9.

Rabbit Polyclonal Anti-KLF9 Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF9 antibody: synthetic peptide directed towards the N terminal of human KLF9. Synthetic peptide located within the following region: ARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKE

Rabbit Polyclonal anti-KLF9 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9. Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

KLF9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1).
Modifications Unmodified