Antibodies

View as table Download

Goat Anti-MEIS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SEDITRSANLTDQ, from the internal region of the protein sequence according to NP_002389.1.

Rabbit Polyclonal Anti-MEIS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the middle region of human MEIS1. Synthetic peptide located within the following region: GKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGT

Rabbit Polyclonal Anti-MEIS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MEIS1 Antibody: synthetic peptide directed towards the C terminal of human MEIS1. Synthetic peptide located within the following region: AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM

MEIS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human MEIS1.