MLNR rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MLNR |
MLNR rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MLNR |
Rabbit polyclonal anti-MTLR antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MTLR. |
Rabbit Polyclonal Anti-MLNR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLNR antibody is: synthetic peptide directed towards the C-terminal region of Human MLNR. Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD |