Antibodies

Jump to Filters
View as table Download
MTRR Rabbit Polyclonal Antibody
TA344668

USD 475.00

5 Days

Rabbit Polyclonal Anti-MTRR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTRR antibody: synthetic peptide directed towards the N terminal of human MTRR. Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
MTRR Rabbit Polyclonal Antibody
TA378788

USD 220.00

3 Weeks

MTRR Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human MTRR (NP_002445.2).
Modifications Unmodified