Antibodies

Jump to Filters
View as table Download
NDRG4 Rabbit Polyclonal Antibody
TA315761

USD 345.00

In Stock

Rabbit polyclonal anti-NDRG4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDRG4.
NDRG4 Rabbit Polyclonal Antibody
TA338023

USD 375.00

5 Days

Rabbit Polyclonal Anti-NDRG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the N-terminal region of Human NDRG4. Synthetic peptide located within the following region: EKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGN
NDRG4 Rabbit Polyclonal Antibody
TA338024

USD 375.00

5 Days

Rabbit Polyclonal Anti-NDRG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the C-terminal region of Human NDRG4. Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME
NDRG4 Rabbit Polyclonal Antibody
TA378987

USD 220.00

3 Weeks

NDRG4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human NDRG4 (NP_001229765.1).
Modifications Unmodified