Antibodies

View as table Download

Rabbit Polyclonal Anti-NSUN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NSUN2 antibody: synthetic peptide directed towards the C terminal of human NSUN2. Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

NSUN2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 508-767 of human NSUN2 (NP_060225.4).
Modifications Unmodified