Antibodies

View as table Download

Rabbit Polyclonal Anti-P2RX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX5 antibody: synthetic peptide directed towards the N terminal of human P2RX5. Synthetic peptide located within the following region: LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR

P2RX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2).
Modifications Unmodified