Antibodies

Jump to Filters
View as table Download
GPR105 (P2RY14) Rabbit Polyclonal Antibody
TA338075

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RY14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI
GPR105 (P2RY14) Rabbit Polyclonal Antibody
TA379557

USD 220.00

3 Weeks

P2RY14 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 209-338 of human P2RY14 (NP_055694.3).
Modifications Unmodified