Antibodies

Jump to Filters
View as table Download
PDE6 alpha (PDE6A) Rabbit Polyclonal Antibody
TA335152

USD 375.00

5 Days

Rabbit polyclonal Anti-PDE6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE6A antibody is: synthetic peptide directed towards the N-terminal region of Human PDE6A. Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK
PDE6 alpha (PDE6A) Rabbit Polyclonal Antibody
TA379735

USD 220.00

3 Weeks

PDE6A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 656-860 of human PDE6A (NP_000431.2).
Modifications Unmodified