Antibodies

Jump to Filters
View as table Download
PPP2R3A Rabbit Polyclonal Antibody
TA337691

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP2R3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R3A antibody: synthetic peptide directed towards the N terminal of human PPP2R3A. Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
PPP2R3A Rabbit Polyclonal Antibody
TA351554

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP2R3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPP2R3A
PPP2R3A Rabbit Polyclonal Antibody
TA367205

USD 380.00

4 Weeks

PPP2R3A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPP2R3A