Antibodies

Jump to Filters
View as table Download
SIM1 Rabbit Polyclonal Antibody
TA344203

USD 475.00

5 Days

Rabbit Polyclonal Anti-SIPA1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIPA1 antibody: synthetic peptide directed towards the middle region of human SIPA1. Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS