Antibodies

Jump to Filters
View as table Download
Syntaxin 7 (STX7) Rabbit Polyclonal Antibody
TA343113

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS
Syntaxin 7 (STX7) Rabbit Polyclonal Antibody
TA382171

USD 220.00

3 Weeks

STX7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human STX7 (NP_003560.2).
Modifications Unmodified