Antibodies

Jump to Filters
View as table Download
UBE2S Rabbit Polyclonal Antibody
TA590247

USD 409.00

In Stock

Rabbit Polyclonal UBE2S Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501).
UBE2S Rabbit Polyclonal Antibody
TA329841

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBE2S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S. Synthetic peptide located within the following region: NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE
UBE2S Rabbit Polyclonal Antibody
TA349911

USD 345.00

In Stock

Rabbit Polyclonal Anti-UBE2S Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBE2S
UBE2S Rabbit Polyclonal Antibody
TA383027

USD 220.00

3 Weeks

UBE2S Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 122-221 of human UBE2S (NP_055316.2).
Modifications Unmodified