Antibodies

View as table Download

Rabbit Polyclonal Anti-UQCC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UQCC antibody is: synthetic peptide directed towards the N-terminal region of Human UQCC. Synthetic peptide located within the following region: RCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQ

UQCC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UQCC1.