Antibodies

View as table Download

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.

Mouse Monoclonal beta-Catenin Antibody (12F7)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit polyclonal antibody to Axin 1 (axin 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169)

Rabbit Polyclonal Patched 1 Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 269-279 of the human and mouse PTCH protein.