Antibodies

View as table Download

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Goat Polyclonal Antibody against HSD3B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DRHKETLKSKTQ, from the C Terminus of the protein sequence according to NP_000853.1.

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B1