SA1 (STAG1) (1112-1221) mouse monoclonal antibody, clone 2E9, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
SA1 (STAG1) (1112-1221) mouse monoclonal antibody, clone 2E9, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
SA1 (STAG1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 539-568 amino acids from the Central region of human STAG1 |
Rabbit Polyclonal Anti-STAG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STAG1 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN STAG1. Synthetic peptide located within the following region: PRKSPGEKSRIEAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQ |