Anti-Human LEC Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human LEC (CCL16) |
Anti-Human LEC Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human LEC (CCL16) |
Rabbit Polyclonal anti-CCL16 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16. Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL |
Rabbit Polyclonal Anti-CCL16 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCL16 |