Antibodies

View as table Download

Rabbit polyclonal anti-AIM2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIM2.

Rabbit polyclonal anti-CSRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSRL1.

AIM2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 11~40 amino acids from the N-terminal region of human AIM2

Mouse monoclonal AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Goat Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKQYKSVTKPKPLSQ, from the internal region of the protein sequence according to NP_004824.1.

Mouse monoclonal anti-AIM2 antibody(Ascites)

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal AIM2 Antibody (10M5G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal AIM2 Antibody (10M2B3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL