Antibodies

Jump to Filters
View as table Download
IL5 Rabbit Polyclonal Antibody
AP20595PU-N

USD 370.00

2 Weeks

IL5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5
IL5 Rabbit Polyclonal Antibody
TA328213

USD 285.00

5 Days

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5
IL5 Rabbit Polyclonal Antibody
TA347874

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5
IL5 Rabbit Polyclonal Antibody
TA336214

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL