Antibodies

View as table Download

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI3D5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI1B1

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI7B2

Applications WB
Reactivities Human
Conjugation Unconjugated