Antibodies

View as table Download

Rabbit Polyclonal Anti-CSGALNACT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSGALNACT1 antibody: synthetic peptide directed towards the N terminal of human CSGALNACT1. Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Rabbit Polyclonal Anti-ChGn Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ChGn antibody: synthetic peptide directed towards the C terminal of human ChGn. Synthetic peptide located within the following region: DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT